PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_F3AB558D4.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HSF
Protein Properties Length: 91aa    MW: 10093.1 Da    PI: 9.2281
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_F3AB558D4.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind452.8e-144691247
                           HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT CS
           HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkh 47
                           Fl+k+y++++d+++++++sw++ gnsfv++d + f++++L+++Fkh
  Traes_4BL_F3AB558D4.1 46 FLTKVYDMVSDAATDKVMSWTDAGNSFVIWDAHAFERDLLSRHFKH 91
                           9********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.8E-153991IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004150.00314291IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467855.71E-124391IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004476.0E-114691IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.4E-64669IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.4E-68491IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
GFRSPHRHGL QQRLAXXXXX XXXXSSAGNA PAPVGPAPRP PEVAPFLTKV YDMVSDAATD  60
KVMSWTDAGN SFVIWDAHAF ERDLLSRHFK H
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3629972e-69AK362997.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2012C04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753057.12e-28PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor A-9-like
SwissprotQ10PR41e-23HSFA9_ORYSJ; Heat stress transcription factor A-9
TrEMBLW5E8D12e-53W5E8D1_WHEAT; Uncharacterized protein
STRINGBRADI1G69407.14e-28(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26150.15e-16heat shock transcription factor A2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]